Lineage for d1fd4f_ (1fd4 F:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 89448Fold g.9: Defensin-like [57391] (1 superfamily)
  4. 89449Superfamily g.9.1: Defensin-like [57392] (1 family) (S)
  5. 89450Family g.9.1.1: Defensin [57393] (9 proteins)
  6. 89464Protein Beta-defensin, BD [63384] (5 species)
  7. 89469Species Human (Homo sapiens), HBD2 [TaxId:9606] [63385] (4 PDB entries)
  8. 89479Domain d1fd4f_: 1fd4 F: [44581]

Details for d1fd4f_

PDB Entry: 1fd4 (more details), 1.7 Å

PDB Description: human beta-defensin 2

SCOP Domain Sequences for d1fd4f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fd4f_ g.9.1.1 (F:) Beta-defensin, BD {Human (Homo sapiens), HBD2}
gigdpvtclksgaichpvfcprrykqigtcglpgtkcckkp

SCOP Domain Coordinates for d1fd4f_:

Click to download the PDB-style file with coordinates for d1fd4f_.
(The format of our PDB-style files is described here.)

Timeline for d1fd4f_: