Lineage for d1fd3a_ (1fd3 A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2637642Fold g.9: Defensin-like [57391] (1 superfamily)
    Disulfide-rich fold, nearly all-beta
  4. 2637643Superfamily g.9.1: Defensin-like [57392] (3 families) (S)
  5. 2637644Family g.9.1.1: Defensin [57393] (11 proteins)
  6. 2637658Protein Beta-defensin, BD [63384] (7 species)
  7. 2637670Species Human (Homo sapiens), HBD2 [TaxId:9606] [63385] (5 PDB entries)
  8. 2637671Domain d1fd3a_: 1fd3 A: [44572]
    complexed with so4

Details for d1fd3a_

PDB Entry: 1fd3 (more details), 1.35 Å

PDB Description: human beta-defensin 2
PDB Compounds: (A:) beta-defensin 2

SCOPe Domain Sequences for d1fd3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fd3a_ g.9.1.1 (A:) Beta-defensin, BD {Human (Homo sapiens), HBD2 [TaxId: 9606]}
gigdpvtclksgaichpvfcprrykqigtcglpgtkcckkp

SCOPe Domain Coordinates for d1fd3a_:

Click to download the PDB-style file with coordinates for d1fd3a_.
(The format of our PDB-style files is described here.)

Timeline for d1fd3a_: