Lineage for d1fd3a_ (1fd3 A:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 89448Fold g.9: Defensin-like [57391] (1 superfamily)
  4. 89449Superfamily g.9.1: Defensin-like [57392] (1 family) (S)
  5. 89450Family g.9.1.1: Defensin [57393] (9 proteins)
  6. 89464Protein Beta-defensin, BD [63384] (5 species)
  7. 89469Species Human (Homo sapiens), HBD2 [TaxId:9606] [63385] (4 PDB entries)
  8. 89470Domain d1fd3a_: 1fd3 A: [44572]

Details for d1fd3a_

PDB Entry: 1fd3 (more details), 1.35 Å

PDB Description: human beta-defensin 2

SCOP Domain Sequences for d1fd3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fd3a_ g.9.1.1 (A:) Beta-defensin, BD {Human (Homo sapiens), HBD2}
gigdpvtclksgaichpvfcprrykqigtcglpgtkcckkp

SCOP Domain Coordinates for d1fd3a_:

Click to download the PDB-style file with coordinates for d1fd3a_.
(The format of our PDB-style files is described here.)

Timeline for d1fd3a_: