SCOPe 2.08: Domain d1adza_: 1adz A:

Lineage for d1adza_ (1adz A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)

6. Protein Tissue factor pathway inhibitor [57368] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57369] (4 PDB entries)

8. Domain d1adza_: 1adz A: [44542]
   second kunitz domain

Details for d1adza_

PDB Entry: 1adz

PDB Description: the solution structure of the second kunitz domain of tissue factor pathway inhibitor, nmr, 30 structures

PDB Compounds: (A:) tissue factor pathway inhibitor

SCOPe Domain Sequences for d1adza_:

Sequence; same for both SEQRES and ATOM records:

>d1adza_ g.8.1.1 (A:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]}
dykddddklkpdfcfleedpgicrgyitryfynnqtkqcerfkyggclgnmnnfetleec
knicedgpngf

Timeline for d1adza_:

• d1adza_ first appeared (with stable ids) in SCOP 1.55, called d1adz__
  
• d1adza_ appears in SCOPe 2.07