Lineage for d1tfxc_ (1tfx C:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 890511Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 890512Superfamily g.8.1: BPTI-like [57362] (3 families) (S)
  5. 890513Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (12 proteins)
  6. 890675Protein Tissue factor pathway inhibitor [57368] (1 species)
  7. 890676Species Human (Homo sapiens) [TaxId:9606] [57369] (4 PDB entries)
  8. 890679Domain d1tfxc_: 1tfx C: [44540]
    Other proteins in same PDB: d1tfxa_, d1tfxb_
    second kunitz domain

Details for d1tfxc_

PDB Entry: 1tfx (more details), 2.6 Å

PDB Description: complex of the second kunitz domain of tissue factor pathway inhibitor with porcine trypsin
PDB Compounds: (C:) tissue factor pathway inhibitor

SCOP Domain Sequences for d1tfxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfxc_ g.8.1.1 (C:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]}
kpdfcfleedpgicrgyitryfynnqtkqcerfkyggclgnmnnfetleecknicedg

SCOP Domain Coordinates for d1tfxc_:

Click to download the PDB-style file with coordinates for d1tfxc_.
(The format of our PDB-style files is described here.)

Timeline for d1tfxc_: