Lineage for d1bhcf_ (1bhc F:)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 269882Fold g.8: BPTI-like [57361] (1 superfamily)
    disulphide-rich alpha+beta fold
  4. 269883Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 269884Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (11 proteins)
  6. 269921Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)
  7. 269922Species Cow (Bos taurus) [TaxId:9913] [57365] (55 PDB entries)
  8. 269993Domain d1bhcf_: 1bhc F: [44528]

Details for d1bhcf_

PDB Entry: 1bhc (more details), 2.7 Å

PDB Description: bovine pancreatic trypsin inhibitor crystallized from thiocyanate

SCOP Domain Sequences for d1bhcf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhcf_ g.8.1.1 (F:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus)}
rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcg

SCOP Domain Coordinates for d1bhcf_:

Click to download the PDB-style file with coordinates for d1bhcf_.
(The format of our PDB-style files is described here.)

Timeline for d1bhcf_: