Lineage for d3btmi_ (3btm I:)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 269882Fold g.8: BPTI-like [57361] (1 superfamily)
    disulphide-rich alpha+beta fold
  4. 269883Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 269884Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (11 proteins)
  6. 269921Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)
  7. 269922Species Cow (Bos taurus) [TaxId:9913] [57365] (55 PDB entries)
  8. 269942Domain d3btmi_: 3btm I: [44481]
    Other proteins in same PDB: d3btme_
    complexed with ca, so4; mutant

Details for d3btmi_

PDB Entry: 3btm (more details), 1.8 Å

PDB Description: the crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti

SCOP Domain Sequences for d3btmi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3btmi_ g.8.1.1 (I:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus)}
dfcleppytgpcmariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga

SCOP Domain Coordinates for d3btmi_:

Click to download the PDB-style file with coordinates for d3btmi_.
(The format of our PDB-style files is described here.)

Timeline for d3btmi_:

269942
d3btmi_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d3btme_