Class g: Small proteins [56992] (91 folds) |
Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (4 families) |
Family g.7.1.1: Snake venom toxins [57303] (28 proteins) automatically mapped to Pfam PF00087 |
Protein Fasciculin [57308] (1 species) different isoforms |
Species Green mamba (Dendroaspis angusticeps) [TaxId:8618] [57309] (11 PDB entries) |
Domain d1mahf_: 1mah F: [44407] Other proteins in same PDB: d1maha_ complexed with nag |
PDB Entry: 1mah (more details), 3.2 Å
SCOPe Domain Sequences for d1mahf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mahf_ g.7.1.1 (F:) Fasciculin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} tmcyshtttsrailtncgenscyrksrrhppkmvlgrgcgcppgddnlevkcctspdkcn y
Timeline for d1mahf_: