![]() | Class g: Small proteins [56992] (85 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (1 family) ![]() |
![]() | Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (1 protein) |
![]() | Protein Bowman-Birk inhibitor, BBI [57249] (8 species) duplication: consists of two sequence repeats each having this fold |
![]() | Species Adzuki bean (Phaseolus angularis) [TaxId:3914] [57255] (1 PDB entry) |
![]() | Domain d1tabi_: 1tab I: [44351] Other proteins in same PDB: d1tabe_ partly disordered |
PDB Entry: 1tab (more details), 2.3 Å
SCOP Domain Sequences for d1tabi_:
Sequence, based on SEQRES records: (download)
>d1tabi_ g.3.13.1 (I:) Bowman-Birk inhibitor, BBI {Adzuki bean (Phaseolus angularis) [TaxId: 3914]} sesskpccdqcsctksmppkcrcsdirlnschsackscactysipakcfctdindfcyep ck
>d1tabi_ g.3.13.1 (I:) Bowman-Birk inhibitor, BBI {Adzuki bean (Phaseolus angularis) [TaxId: 3914]} sesskpccdqcsctksmppkcrcsdirndfcyepck
Timeline for d1tabi_: