SCOP 1.71: Domain d1tabi_: 1tab I:

Lineage for d1tabi_ (1tab I:)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (1 family)

5. Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (1 protein)

6. Protein Bowman-Birk inhibitor, BBI [57249] (8 species)
   duplication: consists of two sequence repeats each having this fold

7. Species Adzuki bean (Phaseolus angularis) [TaxId:3914] [57255] (1 PDB entry)

8. Domain d1tabi_: 1tab I: [44351]
   Other proteins in same PDB: d1tabe_
   partly disordered

Details for d1tabi_

PDB Entry: 1tab, 2.3 Å

PDB Description: structure of the trypsin-binding domain of bowman-birk type protease inhibitor and its interaction with trypsin

SCOP Domain Sequences for d1tabi_:

Sequence, based on SEQRES records:

>d1tabi_ g.3.13.1 (I:) Bowman-Birk inhibitor, BBI {Adzuki bean (Phaseolus angularis)}
sesskpccdqcsctksmppkcrcsdirlnschsackscactysipakcfctdindfcyep
ck

Sequence, based on observed residues (ATOM records):

>d1tabi_ g.3.13.1 (I:) Bowman-Birk inhibitor, BBI {Adzuki bean (Phaseolus angularis)}
sesskpccdqcsctksmppkcrcsdirndfcyepck

Timeline for d1tabi_:

• d1tabi_ first appeared (with stable ids) in SCOP 1.55
  
• d1tabi_ appears in SCOP 1.69
  
• d1tabi_ appears in SCOP 1.73
  
• d1tabi_ appears in the current release, SCOPe 2.08