SCOPe 2.07: Domain d1kloa1: 1klo A:11-65

Lineage for d1kloa1 (1klo A:11-65)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.2: Laminin-type module [57233] (1 protein)
   automatically mapped to Pfam PF00053

6. Protein Laminin gamma1 chain [57234] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [57235] (3 PDB entries)

8. Domain d1kloa1: 1klo A:11-65 [44326]

Details for d1kloa1

PDB Entry: 1klo, 2.1 Å

PDB Description: crystal structure of three consecutive laminin-type epidermal growth factor-like (le) modules of laminin gamma1 chain harboring the nidogen binding site

PDB Compounds: (A:) laminin

SCOPe Domain Sequences for d1kloa1:

Sequence; same for both SEQRES and ATOM records:

>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]}
cpcpggsscaivpktkevvcthcptgtagkrcelcddgyfgdplgsngpvrlcrp

Timeline for d1kloa1:

• d1kloa1 first appeared (with stable ids) in SCOP 1.55, called d1klo_1
  
• d1kloa1 appears in SCOPe 2.06
  
• d1kloa1 appears in the current release, SCOPe 2.08