SCOPe 2.03: Domain d1ebva2: 1ebv A:33-73

Lineage for d1ebva2 (1ebv A:33-73)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
   the rest of protein is heme-linked peroxidase, all-alpha fold

7. Species Sheep (Ovis aries) [TaxId:9940] [57211] (25 PDB entries)
   Uniprot P05979 32-584

8. Domain d1ebva2: 1ebv A:33-73 [44252]
   Other proteins in same PDB: d1ebva1
   complexed with hem, nag, scl

Details for d1ebva2

PDB Entry: 1ebv, 3.2 Å

PDB Description: ovine pghs-1 complexed with salicyl hydroxamic acid

PDB Compounds: (A:) prostaglandin h2 synthase

SCOPe Domain Sequences for d1ebva2:

Sequence; same for both SEQRES and ATOM records:

>d1ebva2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]}
vnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe

Timeline for d1ebva2:

• d1ebva2 first appeared (with stable ids) in SCOP 1.55
  
• d1ebva2 appears in SCOPe 2.02
  
• d1ebva2 appears in SCOPe 2.04
  
• d1ebva2 appears in the current release, SCOPe 2.08