Lineage for d1diya2 (1diy A:32-73)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1459078Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1459896Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1459897Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1460212Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
    the rest of protein is heme-linked peroxidase, all-alpha fold
  7. 1460254Species Sheep (Ovis aries) [TaxId:9940] [57211] (25 PDB entries)
    Uniprot P05979 32-584
  8. 1460279Domain d1diya2: 1diy A:32-73 [44249]
    Other proteins in same PDB: d1diya1
    complexed with acd, bog, coh

Details for d1diya2

PDB Entry: 1diy (more details), 3 Å

PDB Description: crystal structure of arachidonic acid bound in the cyclooxygenase active site of pghs-1
PDB Compounds: (A:) prostaglandin h2 synthase-1

SCOPe Domain Sequences for d1diya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1diya2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]}
pvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe

SCOPe Domain Coordinates for d1diya2:

Click to download the PDB-style file with coordinates for d1diya2.
(The format of our PDB-style files is described here.)

Timeline for d1diya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1diya1