SCOP 1.71: Domain d1dval2: 1dva L:87-142

Lineage for d1dval2 (1dva L:87-142)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (6 families)

5. Family g.3.11.1: EGF-type module [57197] (22 proteins)

6. Protein Coagulation factor VIIa [57201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57202] (15 PDB entries)

8. Domain d1dval2: 1dva L:87-142 [44217]
   Other proteins in same PDB: d1dvah_, d1dvai_

Details for d1dval2

PDB Entry: 1dva, 3 Å

PDB Description: crystal structure of the complex between the peptide exosite inhibitor e-76 and coagulation factor viia

SCOP Domain Sequences for d1dval2:

Sequence; same for both SEQRES and ATOM records:

>d1dval2 g.3.11.1 (L:87-142) Coagulation factor VIIa {Human (Homo sapiens)}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile

Timeline for d1dval2:

• d1dval2 first appeared (with stable ids) in SCOP 1.55
  
• d1dval2 appears in SCOP 1.69
  
• d1dval2 appears in SCOP 1.73
  
• d1dval2 appears in the current release, SCOPe 2.08