Lineage for d1dval1 (1dva L:42-86)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 621450Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 622118Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 622119Family g.3.11.1: EGF-type module [57197] (22 proteins)
  6. 622128Protein Coagulation factor VIIa [57201] (1 species)
  7. 622129Species Human (Homo sapiens) [TaxId:9606] [57202] (15 PDB entries)
  8. 622142Domain d1dval1: 1dva L:42-86 [44216]
    Other proteins in same PDB: d1dvah_, d1dvai_

Details for d1dval1

PDB Entry: 1dva (more details), 3 Å

PDB Description: crystal structure of the complex between the peptide exosite inhibitor e-76 and coagulation factor viia

SCOP Domain Sequences for d1dval1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dval1 g.3.11.1 (L:42-86) Coagulation factor VIIa {Human (Homo sapiens)}
isysdgdqcasspcqnggsckdqlqsyicfclpafegrncethkd

SCOP Domain Coordinates for d1dval1:

Click to download the PDB-style file with coordinates for d1dval1.
(The format of our PDB-style files is described here.)

Timeline for d1dval1: