Lineage for d1danl2 (1dan L:87-142)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies) 
Superfamily g.3.11: EGF/Laminin [57196] (4 families) 
Family g.3.11.1: EGF-type module [57197] (16 proteins) 
Protein Coagulation factor VIIa [57201] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57202] (10 PDB entries) 
Domain d1danl2: 1dan L:87-142 [44210]
Other proteins in same PDB: d1dan.1, d1danh_, d1danl3, d1danu1
Details for d1danl2
PDB Entry: 1dan (more details), 2 Å
PDB Description: complex of active site inhibited human blood coagulation factor viia with human recombinant soluble tissue factor
SCOP Domain Sequences for d1danl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1danl2 g.3.11.1 (L:87-142) Coagulation factor VIIa {Human (Homo sapiens)}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile
SCOP Domain Coordinates for d1danl2:
Click to download the PDB-style file with coordinates for d1danl2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1danl2:
- d1danl2 appears in SCOP 1.57
- d1danl2 appears in the current release, SCOPe 2.08
 View in 3DDomains from other chains: (mouse over for more information) d1dan.1, d1dan.1, d1danh_, d1danu1 |
