SCOP 1.57: Domain d1danl2: 1dan L:87-142

Lineage for d1danl2 (1dan L:87-142)

1. Root: SCOP 1.57

2. Class g: Small proteins [56992] (56 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)

4. Superfamily g.3.11: EGF/Laminin [57196] (5 families)

5. Family g.3.11.1: EGF-type module [57197] (17 proteins)

6. Protein Coagulation factor VIIa [57201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57202] (11 PDB entries)

8. Domain d1danl2: 1dan L:87-142 [44210]
   Other proteins in same PDB: d1dan.1, d1danh_, d1danl3, d1danu1

Details for d1danl2

PDB Entry: 1dan, 2 Å

PDB Description: complex of active site inhibited human blood coagulation factor viia with human recombinant soluble tissue factor

SCOP Domain Sequences for d1danl2:

Sequence; same for both SEQRES and ATOM records:

>d1danl2 g.3.11.1 (L:87-142) Coagulation factor VIIa {Human (Homo sapiens)}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile

Timeline for d1danl2:

• d1danl2 first appeared (with stable ids) in SCOP 1.55
  
• d1danl2 appears in SCOP 1.59
  
• d1danl2 appears in the current release, SCOPe 2.08