Lineage for d1pfxl1 (1pfx L:47-86)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. Protein Factor IX (IXa) [57198] (2 species)
  7. Species Pig (Sus scrofa) [TaxId:9823] [57200] (2 PDB entries)
  8. Domain d1pfxl1: 1pfx L:47-86 [44207]
    Other proteins in same PDB: d1pfxc_, d1pfxl3
    complexed with 0g6

Details for d1pfxl1

PDB Entry: 1pfx (more details), 3 Å

PDB Description: porcine factor ixa
PDB Compounds: (L:) factor ixa

SCOPe Domain Sequences for d1pfxl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pfxl1 g.3.11.1 (L:47-86) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}
dgdqcepnpclngglckddinsyecwcqvgfegkncelda

SCOPe Domain Coordinates for d1pfxl1 are not available.

Timeline for d1pfxl1:

Domains from same chain:
(mouse over for more information)
d1pfxl2, d1pfxl3
Domains from other chains:
(mouse over for more information)
d1pfxc_