| Class g: Small proteins [56992] (100 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.10: Colipase-like [57190] (2 families) ![]() |
| Family g.3.10.1: Colipase-like [57191] (2 proteins) |
| Protein (Pro)colipase [57192] (1 species) duplication: consists of two (sub)domains of this common fold |
| Species Pig (Sus scrofa) [TaxId:9823] [57193] (6 PDB entries) |
| Domain d1ethb2: 1eth B:45-90 [44194] Other proteins in same PDB: d1etha1, d1etha2, d1ethc1, d1ethc2 complexed with bme, c8e, ca |
PDB Entry: 1eth (more details), 2.8 Å
SCOPe Domain Sequences for d1ethb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ethb2 g.3.10.1 (B:45-90) (Pro)colipase {Pig (Sus scrofa) [TaxId: 9823]}
ensecsaftlygvyykcpcergltcegdkslvgsitntnfgichnv
Timeline for d1ethb2: