Lineage for d1lghb_ (1lgh B:)

  1. Root: SCOP 1.59
  2. 141686Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 142238Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
  4. 142239Superfamily f.3.1: Light-harvesting complex subunits [56918] (1 family) (S)
  5. 142240Family f.3.1.1: Light-harvesting complex subunits [56919] (1 protein)
  6. 142241Protein Light-harvesting complex subunits [56920] (4 species)
  7. 142259Species Rhodospirillum molischianum [TaxId:1083] [56922] (1 PDB entry)
  8. 142261Domain d1lghb_: 1lgh B: [43734]

Details for d1lghb_

PDB Entry: 1lgh (more details), 2.4 Å

PDB Description: crystal structure of the light-harvesting complex ii (b800-850) from rhodospirillum molischianum

SCOP Domain Sequences for d1lghb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lghb_ f.3.1.1 (B:) Light-harvesting complex subunits {Rhodospirillum molischianum}
rslsglteeeaiavhdqfkttfsafiilaavahvlvwvwkpwf

SCOP Domain Coordinates for d1lghb_:

Click to download the PDB-style file with coordinates for d1lghb_.
(The format of our PDB-style files is described here.)

Timeline for d1lghb_: