![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families) ![]() |
![]() | Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein) |
![]() | Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (4 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [81492] (3 PDB entries) |
![]() | Domain d2bccd3: 2bcc D:196-241 [43705] Other proteins in same PDB: d2bcca1, d2bcca2, d2bccb1, d2bccb2, d2bccc2, d2bccc3, d2bccd2, d2bcce1, d2bcce2, d2bccf_, d2bccg_, d2bcch_, d2bccj_ complexed with bog, fes, hem, pee, sig, u10 |
PDB Entry: 2bcc (more details), 3.5 Å
SCOPe Domain Sequences for d2bccd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bccd3 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Chicken (Gallus gallus) [TaxId: 9031]} pehdhrkrmglkmllmmgllvplvyymkrhkwsvlksrklayrppk
Timeline for d2bccd3: