Lineage for d1bgyg_ (1bgy G:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025949Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) (S)
    automatically mapped to Pfam PF02939
  5. 3025950Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)
  6. 3025951Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
    together with cytochrome b binds to ubiquinone
  7. 3025971Species Cow (Bos taurus) [TaxId:9913] [81503] (21 PDB entries)
    Uniprot P13271 #SP ! Uniprot P13271
  8. 3025994Domain d1bgyg_: 1bgy G: [43685]
    Other proteins in same PDB: d1bgya1, d1bgya2, d1bgyb1, d1bgyb2, d1bgyc2, d1bgyc3, d1bgyd2, d1bgyd3, d1bgye_, d1bgyf_, d1bgyh_, d1bgyi_, d1bgyj_, d1bgyk_, d1bgym1, d1bgym2, d1bgyn1, d1bgyn2, d1bgyo2, d1bgyo3, d1bgyp2, d1bgyp3, d1bgyq1, d1bgyq2, d1bgyr_, d1bgyt_, d1bgyu_, d1bgyv_, d1bgyw_
    complexed with fes, hec, hem

Details for d1bgyg_

PDB Entry: 1bgy (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine
PDB Compounds: (G:) cytochrome bc1 complex

SCOPe Domain Sequences for d1bgyg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgyg_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
wgtqefekskrknpaayendr

SCOPe Domain Coordinates for d1bgyg_:

Click to download the PDB-style file with coordinates for d1bgyg_.
(The format of our PDB-style files is described here.)

Timeline for d1bgyg_: