![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.19: Aquaporin-like [81339] (1 superfamily) core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices |
![]() | Superfamily f.19.1: Aquaporin-like [81338] (2 families) ![]() |
![]() | Family f.19.1.1: Aquaporin-like [56895] (5 proteins) duplication: consist of two similar structural parts automatically mapped to Pfam PF00230 |
![]() | Protein Glycerol uptake facilitator protein GlpF [56898] (1 species) glycerol conducting channel, related to aquaporin |
![]() | Species Escherichia coli [TaxId:562] [56899] (4 PDB entries) |
![]() | Domain d1fx8a_: 1fx8 A: [43651] complexed with bog, gol |
PDB Entry: 1fx8 (more details), 2.2 Å
SCOPe Domain Sequences for d1fx8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fx8a_ f.19.1.1 (A:) Glycerol uptake facilitator protein GlpF {Escherichia coli [TaxId: 562]} tlkgqciaeflgtglliffgvgcvaalkvagasfgqweisviwglgvamaiyltagvsga hlnpavtialwlfacfdkrkvipfivsqvagafcaaalvyglyynlffdfeqthhivrgs vesvdlagtfstypnphinfvqafavemvitailmglilaltddgngvprgplaplligl liavigasmgpltgfamnpardfgpkvfawlagwgnvaftggrdipyflvplfgpivgai vgafayrkligrhl
Timeline for d1fx8a_: