SCOP 1.57: Domain d1ehkc1: 1ehk C:

Lineage for d1ehkc1 (1ehk C:)

1. Root: SCOP 1.57

2. Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (10 families)

5. Family f.2.1.3: Cytochrome c oxidase-like [56883] (2 proteins)

6. Protein Cytochrome c oxidase [56884] (3 species)

7. Species Thermus thermophilus, ba3 type [TaxId:274] [56887] (1 PDB entry)

8. Domain d1ehkc1: 1ehk C: [43626]
   Other proteins in same PDB: d1ehkb1

Details for d1ehkc1

PDB Entry: 1ehk, 2.4 Å

PDB Description: crystal structure of the aberrant ba3-cytochrome-c oxidase from thermus thermophilus

SCOP Domain Sequences for d1ehkc1:

Sequence; same for both SEQRES and ATOM records:

>d1ehkc1 f.2.1.3 (C:) Cytochrome c oxidase {Thermus thermophilus, ba3 type}
eekpkgalavilvltltilvfwlgvyavffarg

Timeline for d1ehkc1:

• d1ehkc1 first appeared (with stable ids) in SCOP 1.55
  
• d1ehkc1 appears in SCOP 1.59
  
• d1ehkc1 appears in the current release, SCOPe 2.08, called d1ehkc_