SCOP 1.75: Domain d1occv_: 1occ V:

Lineage for d1occv_ (1occ V:)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family)

5. Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein)

6. Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81412] (14 PDB entries)

8. Domain d1occv_: 1occ V: [43573]
   Other proteins in same PDB: d1occa_, d1occb1, d1occb2, d1occc_, d1occd_, d1occe_, d1occf_, d1occg_, d1occh_, d1occj_, d1occk_, d1occl_, d1occm_, d1occn_, d1occo1, d1occo2, d1occp_, d1occq_, d1occr_, d1occs_, d1occt_, d1occu_, d1occw_, d1occx_, d1occy_, d1occz_
   complexed with cu, hea, mg, zn

Details for d1occv_

PDB Entry: 1occ, 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state

PDB Compounds: (V:) cytochrome c oxidase

SCOP Domain Sequences for d1occv_:

Sequence; same for both SEQRES and ATOM records:

>d1occv_ f.23.3.1 (V:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]}
stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
eemrkagifqsak

Timeline for d1occv_:

• d1occv_ first appeared (with stable ids) in SCOP 1.55, called d1occv1
  
• d1occv_ appears in SCOP 1.73
  
• d1occv_ appears in SCOPe 2.01
  
• d1occv_ appears in the current release, SCOPe 2.08