SCOPe 2.08: Domain d2occy_: 2occ Y:

Lineage for d2occy_ (2occ Y:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.6: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81427] (1 family)
   automatically mapped to Pfam PF02935

5. Family f.23.6.1: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81426] (2 proteins)

6. Protein Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81425] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81424] (50 PDB entries)

8. Domain d2occy_: 2occ Y: [43536]
   Other proteins in same PDB: d2occa_, d2occb1, d2occb2, d2occc_, d2occd_, d2occe_, d2occf_, d2occg_, d2occh_, d2occi_, d2occj_, d2occk_, d2occm_, d2occn_, d2occo1, d2occo2, d2occp_, d2occq_, d2occr_, d2occs_, d2occt_, d2occu_, d2occv_, d2occw_, d2occx_, d2occz_
   complexed with cu, hea, mg, na, per, zn

Details for d2occy_

PDB Entry: 2occ, 2.3 Å

PDB Description: bovine heart cytochrome c oxidase at the fully oxidized state

PDB Compounds: (Y:) cytochrome c oxidase

SCOPe Domain Sequences for d2occy_:

Sequence; same for both SEQRES and ATOM records:

>d2occy_ f.23.6.1 (Y:) Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) {Cow (Bos taurus) [TaxId: 9913]}
shyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk

Timeline for d2occy_:

• d2occy_ first appeared (with stable ids) in SCOP 1.55, called d2occy1
  
• d2occy_ appears in SCOPe 2.07