Lineage for d1ysth2 (1yst H:1-35)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2630999Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families) (S)
  5. 2631000Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)
  6. 2631001Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (4 species)
  7. 2631002Species Rhodobacter sphaeroides [TaxId:1063] [81486] (87 PDB entries)
    Uniprot P11846
  8. 2631096Domain d1ysth2: 1yst H:1-35 [43511]
    Other proteins in same PDB: d1ysth1, d1ystl_, d1ystm_
    complexed with bcl, bph, mn, spo, u10

Details for d1ysth2

PDB Entry: 1yst (more details), 3 Å

PDB Description: structure of the photochemical reaction center of a spheroidene containing purple bacterium, rhodobacter sphaeroides y, at 3 angstroms resolution
PDB Compounds: (H:) photosynthetic reaction center (h subunit)

SCOPe Domain Sequences for d1ysth2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ysth2 f.23.10.1 (H:1-35) Photosystem II reaction centre subunit H, transmembrane region {Rhodobacter sphaeroides [TaxId: 1063]}
mvgvtafgnfdlaslaiysfwiflagliyylqten

SCOPe Domain Coordinates for d1ysth2:

Click to download the PDB-style file with coordinates for d1ysth2.
(The format of our PDB-style files is described here.)

Timeline for d1ysth2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ysth1