Lineage for d6prcm_ (6prc M:)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 520396Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 520397Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 520398Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
    L and M are probably related to each other
  6. 520460Protein M (medium) subunit [81481] (3 species)
  7. 520509Species Rhodopseudomonas viridis [TaxId:1079] [81478] (9 PDB entries)
  8. 520511Domain d6prcm_: 6prc M: [43435]
    Other proteins in same PDB: d6prcc_, d6prch1, d6prch2, d6prcl_

Details for d6prcm_

PDB Entry: 6prc (more details), 2.3 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (dg-420314 (triazine) complex)

SCOP Domain Sequences for d6prcm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6prcm_ f.26.1.1 (M:) M (medium) subunit {Rhodopseudomonas viridis}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk

SCOP Domain Coordinates for d6prcm_:

Click to download the PDB-style file with coordinates for d6prcm_.
(The format of our PDB-style files is described here.)

Timeline for d6prcm_: