Class f: Membrane and cell surface proteins and peptides [56835] (47 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins) L and M are probably related to each other |
Protein M (medium) subunit [81481] (3 species) |
Species Rhodopseudomonas viridis [TaxId:1079] [81478] (9 PDB entries) |
Domain d6prcm_: 6prc M: [43435] Other proteins in same PDB: d6prcc_, d6prch1, d6prch2, d6prcl_ |
PDB Entry: 6prc (more details), 2.3 Å
SCOP Domain Sequences for d6prcm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6prcm_ f.26.1.1 (M:) M (medium) subunit {Rhodopseudomonas viridis} adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg aapdypaylpatpdpaslpgapk
Timeline for d6prcm_:
View in 3D Domains from other chains: (mouse over for more information) d6prcc_, d6prch1, d6prch2, d6prcl_ |