Lineage for d1bxla_ (1bxl A:)
- Root: SCOP 1.55
Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) 
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) 
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family) 
Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (3 proteins) Protein Apoptosis regulator Bcl-xL [56856] (2 species) Species Human (Homo sapiens) [TaxId:9606] [56857] (4 PDB entries) 
Domain d1bxla_: 1bxl A: [43396]
Details for d1bxla_
PDB Entry: 1bxl (more details)
PDB Description: structure of bcl-xl/bak peptide complex, nmr, minimized average structure
SCOP Domain Sequences for d1bxla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bxla_ f.1.4.1 (A:) Apoptosis regulator Bcl-xL {Human (Homo sapiens)}
msmamsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagde
felryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvd
kemqvlvsriaawmatylndhlepwiqenggwdtfvelygnnaaaesrkgqerlehhhhh
h
SCOP Domain Coordinates for d1bxla_:
Click to download the PDB-style file with coordinates for d1bxla_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bxla_:
- d1bxla_ appears in SCOP 1.57
- d1bxla_ appears in the current release, SCOPe 2.08, called d1bxla1
View in 3D