Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) |
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family) |
Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (3 proteins) |
Protein Apoptosis regulator Bcl-xL [56856] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [56857] (4 PDB entries) |
Domain d1bxla_: 1bxl A: [43396] |
PDB Entry: 1bxl (more details)
SCOP Domain Sequences for d1bxla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bxla_ f.1.4.1 (A:) Apoptosis regulator Bcl-xL {Human (Homo sapiens)} msmamsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagde felryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvd kemqvlvsriaawmatylndhlepwiqenggwdtfvelygnnaaaesrkgqerlehhhhh h
Timeline for d1bxla_: