SCOPe 2.08: Domain d1bxla1: 1bxl A:1-209

Lineage for d1bxla1 (1bxl A:1-209)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Apoptosis regulator Bcl-xL [56856] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56857] (51 PDB entries)

8. Domain d1bxla1: 1bxl A:1-209 [43396]
   Other proteins in same PDB: d1bxla2, d1bxla3

Details for d1bxla1

PDB Entry: 1bxl

PDB Description: structure of bcl-xl/bak peptide complex, nmr, minimized average structure

PDB Compounds: (A:) bcl-xl

SCOPe Domain Sequences for d1bxla1:

Sequence, based on SEQRES records:

>d1bxla1 f.1.4.1 (A:1-209) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqfsdveenrteapegtesemetpsaingnpswhla
dspavngatghsssldarevipmaavkqalreagdefelryrrafsdltsqlhitpgtay
qsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylndhlep
wiqenggwdtfvelygnnaaaesrkgqer

Sequence, based on observed residues (ATOM records):

>d1bxla1 f.1.4.1 (A:1-209) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagdefelr
yrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemq
vlvsriaawmatylndhlepwiqenggwdtfvelygnnaaaesrkgqer

Timeline for d1bxla1:

• d1bxla1 first appeared (with stable ids) in SCOP 1.55, called d1bxla_
  
• d1bxla1 appears in SCOPe 2.07