Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.2: Reverse transcriptase [56686] (2 proteins) |
Protein HIV-1 reverse transcriptase [56689] (2 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (71 PDB entries) |
Domain d1uwba2: 1uwb A:1-429 [43062] Other proteins in same PDB: d1uwba1 complexed with tbo; mutant |
PDB Entry: 1uwb (more details), 3.2 Å
SCOP Domain Sequences for d1uwba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uwba2 e.8.1.2 (A:1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1} pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi cqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp plvklwyql
Timeline for d1uwba2: