Lineage for d1har__ (1har -)

  1. Root: SCOP 1.63
  2. 266016Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 266689Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
  4. 266690Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 266747Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 266748Protein HIV-1 reverse transcriptase [56689] (2 species)
  7. 266749Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (63 PDB entries)
  8. 266752Domain d1har__: 1har - [43025]
    fragment of "palm" and "fingers" domains

Details for d1har__

PDB Entry: 1har (more details), 2.2 Å

PDB Description: 2.2 angstroms resolution structure of the amino-terminal half of hiv-1 reverse transcriptase (fingers and palm subdomains)

SCOP Domain Sequences for d1har__:

Sequence, based on SEQRES records: (download)

>d1har__ e.8.1.2 (-) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
pispietvpvklkpgmdgpkvaqwpltaakiaalvaictemekegkiskigpenpyntpv
faikkkdstkwaklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilapfkaanpdivi
yqymddlyvgsdlaigahrtkieelrqhllrwgltt

Sequence, based on observed residues (ATOM records): (download)

>d1har__ e.8.1.2 (-) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
pispietvpvklkpgmdgpkvaqwpltaakiaalvaictemekegkiskigpenpyntpv
faiwaklvdfrelnkrtqdfwevksvtvldvgdayfsvpldedfrkytaftipsinnetp
giryqynvlpqgwkgspaifqssmtkilapfkaanpdiviyqymddlyvgsdlaigahrt
kieelrqhllrwgltt

SCOP Domain Coordinates for d1har__:

Click to download the PDB-style file with coordinates for d1har__.
(The format of our PDB-style files is described here.)

Timeline for d1har__: