Lineage for d1rdzb_ (1rdz B:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1451563Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 1451564Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 1451565Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. 1451598Protein Fructose-1,6-bisphosphatase [56657] (7 species)
  7. 1451627Species Pig (Sus scrofa) [TaxId:9823] [56658] (62 PDB entries)
  8. 1451660Domain d1rdzb_: 1rdz B: [42883]
    complexed with amp, f6p; mutant

Details for d1rdzb_

PDB Entry: 1rdz (more details), 2.05 Å

PDB Description: t-state structure of the arg 243 to ala mutant of pig kidney fructose 1,6-bisphosphatase expressed in e. coli
PDB Compounds: (B:) fructose 1,6-bisphosphatase

SCOPe Domain Sequences for d1rdzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rdzb_ e.7.1.1 (B:) Fructose-1,6-bisphosphatase {Pig (Sus scrofa) [TaxId: 9823]}
tdqaafdtnivtltrfvmeqgrkargtgemtqllnslctavkaistavrkagiahlygia
gstnvtgdqvkkldvlsndlvinvlkssfatcvlvteedknaiivepekrgkyvvcfdpl
dgssnidclvsigtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvng
vncfmldpaigefilvdrnvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapy
gaayvgsmvadvhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgke
avldivptdihqrapiilgspedvtelleiyqkhaak

SCOPe Domain Coordinates for d1rdzb_:

Click to download the PDB-style file with coordinates for d1rdzb_.
(The format of our PDB-style files is described here.)

Timeline for d1rdzb_: