Lineage for d1mbla_ (1mbl A:)

  1. Root: SCOP 1.57
  2. 86313Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds)
  3. 86412Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily)
  4. 86413Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) (S)
  5. 86414Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (6 proteins)
  6. 86453Protein beta-Lactamase, class A [56606] (12 species)
  7. 86454Species Bacillus licheniformis [TaxId:1402] [56612] (3 PDB entries)
  8. 86457Domain d1mbla_: 1mbl A: [42723]

Details for d1mbla_

PDB Entry: 1mbl (more details), 2 Å

PDB Description: a catalytically-impaired class a beta-lactamase: 2 angstroms crystal structure and kinetics of the bacillus licheniformis e166a mutant

SCOP Domain Sequences for d1mbla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mbla_ e.3.1.1 (A:) beta-Lactamase, class A {Bacillus licheniformis}
ddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedlnq
ritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkelr
kigdevtnperfapelnevnpgetqdtstaralvtslrafaledklpsekrellidwmkr
nttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdakyd
dkliaeatkvvmkaln

SCOP Domain Coordinates for d1mbla_:

Click to download the PDB-style file with coordinates for d1mbla_.
(The format of our PDB-style files is described here.)

Timeline for d1mbla_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mblb_