SCOPe 2.03: Domain d3nsea_: 3nse A:

Lineage for d3nsea_ (3nse A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)
   automatically mapped to Pfam PF02898

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)

6. Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56517] (82 PDB entries)
   Uniprot P29473 67-482

8. Domain d3nsea_: 3nse A: [42546]
   complexed with act, arg, cac, gol, hem, itu, zn

Details for d3nsea_

PDB Entry: 3nse, 2.1 Å

PDB Description: bovine enos, h4b-free, seitu complex

PDB Compounds: (A:) nitric oxide synthase

SCOPe Domain Sequences for d3nsea_:

Sequence; same for both SEQRES and ATOM records:

>d3nsea_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]}
gpkfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqll
sqardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprc
vgriqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriw
nsqlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfv
lppelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigt
rnlcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaat
vsfmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

Timeline for d3nsea_:

• d3nsea_ first appeared (with stable ids) in SCOP 1.55
  
• d3nsea_ appears in SCOPe 2.02
  
• d3nsea_ appears in SCOPe 2.04
  
• d3nsea_ appears in the current release, SCOPe 2.08