Lineage for d1dmka_ (1dmk A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1443752Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 1443753Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 1443754Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 1443755Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 1443763Species Cow (Bos taurus) [TaxId:9913] [56517] (82 PDB entries)
    Uniprot P29473 67-482
  8. 1443802Domain d1dmka_: 1dmk A: [42536]
    complexed with act, ap6, cac, hem, itu, zn

Details for d1dmka_

PDB Entry: 1dmk (more details), 1.9 Å

PDB Description: bovine endothelial nitric oxide synthase heme domain complexed with 4-amino-6-phenyl-tetrahydropteridine
PDB Compounds: (A:) nitric oxide synthase

SCOPe Domain Sequences for d1dmka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dmka_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]}
gpkfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqll
sqardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprc
vgriqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriw
nsqlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfv
lppelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigt
rnlcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaat
vsfmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

SCOPe Domain Coordinates for d1dmka_:

Click to download the PDB-style file with coordinates for d1dmka_.
(The format of our PDB-style files is described here.)

Timeline for d1dmka_: