Lineage for d2nsid_ (2nsi D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1443752Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 1443753Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 1443754Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 1443755Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 1443928Species Human (Homo sapiens) [TaxId:9606] [56516] (10 PDB entries)
  8. 1443954Domain d2nsid_: 2nsi D: [42529]
    complexed with h4b, hem, itu, so4

Details for d2nsid_

PDB Entry: 2nsi (more details), 3 Å

PDB Description: human inducible nitric oxide synthase, zn-free, seitu complex
PDB Compounds: (D:) protein (nitric oxide synthase)

SCOPe Domain Sequences for d2nsid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nsid_ d.174.1.1 (D:) Nitric oxide (NO) synthase oxygenase domain {Human (Homo sapiens) [TaxId: 9606]}
rhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellpq
aiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprcig
riqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwna
qliryagyqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqangrdpelfeip
pdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvrd
fcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaaes
fmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvwq

SCOPe Domain Coordinates for d2nsid_:

Click to download the PDB-style file with coordinates for d2nsid_.
(The format of our PDB-style files is described here.)

Timeline for d2nsid_: