Lineage for d1fzaf1 (1fza F:142-396)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 878620Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 878621Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (1 family) (S)
  5. 878622Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
  6. 878623Protein Fibrinogen C-terminal domains [56498] (7 species)
  7. 878668Species Human (Homo sapiens), gamma [TaxId:9606] [68904] (21 PDB entries)
    Uniprot P02679
  8. 878702Domain d1fzaf1: 1fza F:142-396 [42483]
    Other proteins in same PDB: d1fzaa_, d1fzab2, d1fzac2, d1fzad_, d1fzae2, d1fzaf2
    complexed with ca, nag

Details for d1fzaf1

PDB Entry: 1fza (more details), 2.9 Å

PDB Description: crystal structure of fibrinogen fragment d
PDB Compounds: (F:) fibrinogen

SCOP Domain Sequences for d1fzaf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzaf1 d.171.1.1 (F:142-396) Fibrinogen C-terminal domains {Human (Homo sapiens), gamma [TaxId: 9606]}
tvqihditgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgs
vdfkknwiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstad
yamfkvgpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndk
fegncaeqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkk
ttmkiipfnrltige

SCOP Domain Coordinates for d1fzaf1:

Click to download the PDB-style file with coordinates for d1fzaf1.
(The format of our PDB-style files is described here.)

Timeline for d1fzaf1: