Lineage for d1fzaf1 (1fza F:142-396)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2560074Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 2560075Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) (S)
  5. 2560076Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
    automatically mapped to Pfam PF00147
  6. 2560077Protein Fibrinogen C-terminal domains [56498] (7 species)
  7. 2560122Species Human (Homo sapiens), gamma [TaxId:9606] [68904] (21 PDB entries)
    Uniprot P02679
  8. 2560156Domain d1fzaf1: 1fza F:142-396 [42483]
    Other proteins in same PDB: d1fzaa_, d1fzab2, d1fzac2, d1fzad_, d1fzae2, d1fzaf2
    complexed with ca, nag

Details for d1fzaf1

PDB Entry: 1fza (more details), 2.9 Å

PDB Description: crystal structure of fibrinogen fragment d
PDB Compounds: (F:) fibrinogen

SCOPe Domain Sequences for d1fzaf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzaf1 d.171.1.1 (F:142-396) Fibrinogen C-terminal domains {Human (Homo sapiens), gamma [TaxId: 9606]}
tvqihditgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgs
vdfkknwiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstad
yamfkvgpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndk
fegncaeqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkk
ttmkiipfnrltige

SCOPe Domain Coordinates for d1fzaf1:

Click to download the PDB-style file with coordinates for d1fzaf1.
(The format of our PDB-style files is described here.)

Timeline for d1fzaf1: