Lineage for d1fzec1 (1fze C:142-394)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 514798Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 514799Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (1 family) (S)
  5. 514800Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
  6. 514801Protein Fibrinogen C-terminal domains [56498] (7 species)
  7. 514846Species Human (Homo sapiens), gamma [TaxId:9606] [68904] (19 PDB entries)
  8. 514873Domain d1fzec1: 1fze C:142-394 [42477]
    Other proteins in same PDB: d1fzea_, d1fzeb2, d1fzec2, d1fzed_, d1fzee2, d1fzef2

Details for d1fzec1

PDB Entry: 1fze (more details), 3 Å

PDB Description: crystal structure of fragment double-d from human fibrin

SCOP Domain Sequences for d1fzec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzec1 d.171.1.1 (C:142-394) Fibrinogen C-terminal domains {Human (Homo sapiens), gamma}
tvqihditgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgs
vdfkknwiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstad
yamfkvgpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndk
fegncaeqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkk
ttmkiipfnrlti

SCOP Domain Coordinates for d1fzec1:

Click to download the PDB-style file with coordinates for d1fzec1.
(The format of our PDB-style files is described here.)

Timeline for d1fzec1: