Lineage for d1fzgb1 (1fzg B:200-459)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
unusual foldSuperfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) 
Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
automatically mapped to Pfam PF00147
Protein Fibrinogen C-terminal domains [56498] (7 species) 
Species Human (Homo sapiens), beta [TaxId:9606] [68903] (14 PDB entries)
Uniprot P02675
Domain d1fzgb1: 1fzg B:200-459 [42468]
Other proteins in same PDB: d1fzga_, d1fzgb2, d1fzgc2, d1fzgd_, d1fzge2, d1fzgf2
complexed with ca
Details for d1fzgb1
PDB Entry: 1fzg (more details), 2.5 Å
PDB Description: crystal structure of fragment d from human fibrinogen with the peptide ligand gly-his-arg-pro-amide
PDB Compounds: (B:) fibrinogenSCOPe Domain Sequences for d1fzgb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fzgb1 d.171.1.1 (B:200-459) Fibrinogen C-terminal domains {Human (Homo sapiens), beta [TaxId: 9606]}
scnipvvsgkeceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgs
vdfgrkwdpykqgfgnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkg
dkvkahyggftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstyd
rdndgwltsdprkqcskedgggwwynrchaanpngryywggqytwdmakhgtddgvvwmn
wkgswysmrkmsmkirpffp
SCOPe Domain Coordinates for d1fzgb1:
Click to download the PDB-style file with coordinates for d1fzgb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fzgb1:
View in 3D
