Lineage for d1bcj21 (1bcj 2:105-226)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1682071Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1682072Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1682073Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1682229Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)
  7. 1682232Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)
  8. 1682324Domain d1bcj21: 1bcj 2:105-226 [42412]
    Other proteins in same PDB: d1bcj12, d1bcj22, d1bcj32
    complexed with ca, cl, nga; mutant

Details for d1bcj21

PDB Entry: 1bcj (more details), 2.1 Å

PDB Description: mannose-binding protein-a mutant (qpdwghv) complexed with n-acetyl-d- galactosamine
PDB Compounds: (2:) mannose-binding protein-a

SCOPe Domain Sequences for d1bcj21:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bcj21 d.169.1.1 (2:105-226) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktvaflgitdevt
egqfmyvtggrltysnwkkdqpddwyghglgggedcvhivdnglwndiscqashtavcef
pa

SCOPe Domain Coordinates for d1bcj21:

Click to download the PDB-style file with coordinates for d1bcj21.
(The format of our PDB-style files is described here.)

Timeline for d1bcj21: