Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein Mannose-binding protein A, C-lectin domain [56458] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries) |
Domain d1bch21: 1bch 2:105-226 [42400] Other proteins in same PDB: d1bch12, d1bch22, d1bch32 complexed with a2g, ca, cl, na, nga; mutant |
PDB Entry: 1bch (more details), 2 Å
SCOPe Domain Sequences for d1bch21:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bch21 d.169.1.1 (2:105-226) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt egqfmyvtggrltysnwkkdqpddwyghglgggedcvhivdnglwndiscqashtavcef pa
Timeline for d1bch21:
View in 3D Domains from other chains: (mouse over for more information) d1bch11, d1bch12, d1bch31, d1bch32 |