Lineage for d1rdk1_ (1rdk 1:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1682071Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1682072Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1682073Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1682229Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)
  7. 1682232Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)
  8. 1682258Domain d1rdk1_: 1rdk 1: [42376]
    complexed with ca, cl, gal

Details for d1rdk1_

PDB Entry: 1rdk (more details), 1.8 Å

PDB Description: mannose-binding protein, subtilisin digest fragment complex with d- galactose
PDB Compounds: (1:) mannose-binding protein-c

SCOPe Domain Sequences for d1rdk1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rdk1_ d.169.1.1 (1:) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvfe
dltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs

SCOPe Domain Coordinates for d1rdk1_:

Click to download the PDB-style file with coordinates for d1rdk1_.
(The format of our PDB-style files is described here.)

Timeline for d1rdk1_: