Lineage for d7vvrm_ (7vvr M:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025475Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family) (S)
    automatically mapped to Pfam PF02285
  5. 3025476Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 proteins)
  6. 3025477Protein Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81429] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 3025478Species Cow (Bos taurus) [TaxId:9913] [81428] (33 PDB entries)
  8. 3087342Domain d7vvrm_: 7vvr M: [423659]
    Other proteins in same PDB: d7vvra_, d7vvrb1, d7vvrb2, d7vvrc_, d7vvrd_, d7vvre_, d7vvrf_, d7vvrg_, d7vvrh_, d7vvri_, d7vvrj_, d7vvrk_, d7vvrl_, d7vvrn_, d7vvro1, d7vvro2, d7vvrp_, d7vvrq_, d7vvrr_, d7vvrs_, d7vvrt_, d7vvru_, d7vvrv_, d7vvrw_, d7vvrx_, d7vvry_
    automated match to d1v54m_
    complexed with cdl, chd, cu, cua, cyn, dmu, edo, hea, mg, na, pek, pgv, po4, psc, tgl, zn

Details for d7vvrm_

PDB Entry: 7vvr (more details), 1.65 Å

PDB Description: bovine cytochrome c oxidese in cn-bound mixed valence state at 50 k
PDB Compounds: (M:) cytochrome c oxidase subunit 8b, mitochondrial

SCOPe Domain Sequences for d7vvrm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7vvrm_ f.23.7.1 (M:) Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) {Cow (Bos taurus) [TaxId: 9913]}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks

SCOPe Domain Coordinates for d7vvrm_:

Click to download the PDB-style file with coordinates for d7vvrm_.
(The format of our PDB-style files is described here.)

Timeline for d7vvrm_:

  • d7vvrm_ is new in SCOPe 2.08-stable