![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.5: Rubredoxin-like [57802] (4 families) ![]() |
![]() | Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins) membrane-anchored rubredoxin-like domain automatically mapped to Pfam PF01215 |
![]() | Protein automated matches [254652] (1 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [255694] (7 PDB entries) |
![]() | Domain d7vvrs_: 7vvr S: [423658] Other proteins in same PDB: d7vvra_, d7vvrb1, d7vvrb2, d7vvrc_, d7vvrd_, d7vvre_, d7vvrg_, d7vvrh_, d7vvri_, d7vvrj_, d7vvrk_, d7vvrl_, d7vvrm_, d7vvrn_, d7vvro1, d7vvro2, d7vvrp_, d7vvrq_, d7vvrr_, d7vvrt_, d7vvru_, d7vvrv_, d7vvrw_, d7vvrx_, d7vvry_, d7vvrz_ automated match to d3ag3f_ complexed with cdl, chd, cu, cua, cyn, dmu, edo, hea, mg, na, pek, pgv, po4, psc, tgl, zn |
PDB Entry: 7vvr (more details), 1.65 Å
SCOPe Domain Sequences for d7vvrs_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7vvrs_ g.41.5.3 (S:) automated matches {Cow (Bos taurus) [TaxId: 9913]} sgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgci ceednstviwfwlhkgeaqrcpscgthyklvph
Timeline for d7vvrs_:
![]() Domains from other chains: (mouse over for more information) d7vvra_, d7vvrb1, d7vvrb2, d7vvrc_, d7vvrd_, d7vvre_, d7vvrf_, d7vvrg_, d7vvrh_, d7vvri_, d7vvrj_, d7vvrk_, d7vvrl_, d7vvrm_, d7vvrn_, d7vvro1, d7vvro2, d7vvrp_, d7vvrq_, d7vvrr_, d7vvrt_, d7vvru_, d7vvrv_, d7vvrw_, d7vvrx_, d7vvry_, d7vvrz_ |