Lineage for d7vvrs_ (7vvr S:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036508Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 3036679Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins)
    membrane-anchored rubredoxin-like domain
    automatically mapped to Pfam PF01215
  6. 3036778Protein automated matches [254652] (1 species)
    not a true protein
  7. 3036779Species Cow (Bos taurus) [TaxId:9913] [255694] (7 PDB entries)
  8. 3087341Domain d7vvrs_: 7vvr S: [423658]
    Other proteins in same PDB: d7vvra_, d7vvrb1, d7vvrb2, d7vvrc_, d7vvrd_, d7vvre_, d7vvrg_, d7vvrh_, d7vvri_, d7vvrj_, d7vvrk_, d7vvrl_, d7vvrm_, d7vvrn_, d7vvro1, d7vvro2, d7vvrp_, d7vvrq_, d7vvrr_, d7vvrt_, d7vvru_, d7vvrv_, d7vvrw_, d7vvrx_, d7vvry_, d7vvrz_
    automated match to d3ag3f_
    complexed with cdl, chd, cu, cua, cyn, dmu, edo, hea, mg, na, pek, pgv, po4, psc, tgl, zn

Details for d7vvrs_

PDB Entry: 7vvr (more details), 1.65 Å

PDB Description: bovine cytochrome c oxidese in cn-bound mixed valence state at 50 k
PDB Compounds: (S:) cytochrome c oxidase subunit 5b, mitochondrial

SCOPe Domain Sequences for d7vvrs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7vvrs_ g.41.5.3 (S:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
sgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgci
ceednstviwfwlhkgeaqrcpscgthyklvph

SCOPe Domain Coordinates for d7vvrs_:

Click to download the PDB-style file with coordinates for d7vvrs_.
(The format of our PDB-style files is described here.)

Timeline for d7vvrs_:

  • d7vvrs_ is new in SCOPe 2.08-stable