SCOPe 2.04: Domain d1ytta_: 1ytt A:

Lineage for d1ytta_ (1ytt A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)

8. Domain d1ytta_: 1ytt A: [42361]
   complexed with yb

Details for d1ytta_

PDB Entry: 1ytt, 1.8 Å

PDB Description: yb substituted subtilisin fragment of mannose binding protein-a (sub- mbp-a), mad structure at 110k

PDB Compounds: (A:) mannose-binding protein a

SCOPe Domain Sequences for d1ytta_:

Sequence; same for both SEQRES and ATOM records:

>d1ytta_ d.169.1.1 (A:) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevteg
qfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa

Timeline for d1ytta_:

• d1ytta_ first appeared (with stable ids) in SCOP 1.55
  
• d1ytta_ appears in SCOPe 2.03
  
• d1ytta_ appears in SCOPe 2.05
  
• d1ytta_ appears in the current release, SCOPe 2.08