Lineage for d7vvrn_ (7vvr N:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3026966Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 3026967Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 3026968Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 3027023Protein Mitochondrial cytochrome c oxidase, subunit I [81433] (1 species)
  7. 3027024Species Cow (Bos taurus) [TaxId:9913] [81432] (40 PDB entries)
  8. 3087275Domain d7vvrn_: 7vvr N: [423592]
    Other proteins in same PDB: d7vvrb1, d7vvrb2, d7vvrc_, d7vvrd_, d7vvre_, d7vvrf_, d7vvrg_, d7vvrh_, d7vvri_, d7vvrj_, d7vvrk_, d7vvrl_, d7vvrm_, d7vvro1, d7vvro2, d7vvrp_, d7vvrq_, d7vvrr_, d7vvrs_, d7vvrt_, d7vvru_, d7vvrv_, d7vvrw_, d7vvrx_, d7vvry_, d7vvrz_
    automated match to d1occa_
    complexed with cdl, chd, cu, cua, cyn, dmu, edo, hea, mg, na, pek, pgv, po4, psc, tgl, zn

Details for d7vvrn_

PDB Entry: 7vvr (more details), 1.65 Å

PDB Description: bovine cytochrome c oxidese in cn-bound mixed valence state at 50 k
PDB Compounds: (N:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d7vvrn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7vvrn_ f.24.1.1 (N:) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]}
mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
evltvdltttnlewlngcpppyhtfeeptyvnlk

SCOPe Domain Coordinates for d7vvrn_:

Click to download the PDB-style file with coordinates for d7vvrn_.
(The format of our PDB-style files is described here.)

Timeline for d7vvrn_:

  • d7vvrn_ is new in SCOPe 2.08-stable