Lineage for d2afpa_ (2afp A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737894Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 737895Superfamily d.169.1: C-type lectin-like [56436] (8 families) (S)
  5. 737896Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
    Pfam PF00059
  6. 738275Protein Type II antifreeze protein [56450] (1 species)
  7. 738276Species Sea raven (Hemitripterus americanus) [TaxId:8094] [56451] (1 PDB entry)
  8. 738277Domain d2afpa_: 2afp A: [42349]

Details for d2afpa_

PDB Entry: 2afp (more details)

PDB Description: the solution structure of type ii antifreeze protein reveals a new member of the lectin family
PDB Compounds: (A:) protein (sea raven type II antifreeze protein)

SCOP Domain Sequences for d2afpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2afpa_ d.169.1.1 (A:) Type II antifreeze protein {Sea raven (Hemitripterus americanus) [TaxId: 8094]}
qragpncpagwqplgdrciyyettamtwalaetncmklgghlasihsqeehsfiqtlnag
vvwiggsaclqagawtwsdgtpmnfrswcstkpddvlaaccmqmtaaadqcwddlpcpas
hksvcamtf

SCOP Domain Coordinates for d2afpa_:

Click to download the PDB-style file with coordinates for d2afpa_.
(The format of our PDB-style files is described here.)

Timeline for d2afpa_: