Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (6 families) |
Family d.169.1.1: C-type lectin domain [56437] (26 proteins) Pfam 00059 |
Protein Type II antifreeze protein [56450] (1 species) |
Species Sea raven (Hemitripterus americanus) [TaxId:8094] [56451] (1 PDB entry) |
Domain d2afpa_: 2afp A: [42349] |
PDB Entry: 2afp (more details)
SCOP Domain Sequences for d2afpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2afpa_ d.169.1.1 (A:) Type II antifreeze protein {Sea raven (Hemitripterus americanus)} qragpncpagwqplgdrciyyettamtwalaetncmklgghlasihsqeehsfiqtlnag vvwiggsaclqagawtwsdgtpmnfrswcstkpddvlaaccmqmtaaadqcwddlpcpas hksvcamtf
Timeline for d2afpa_: